Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3419745..3420580 | Replicon | chromosome |
| Accession | NZ_OX030701 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | LQ128_RS16460 | Protein ID | WP_000854759.1 |
| Coordinates | 3420203..3420580 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ128_RS16455 | Protein ID | WP_001295723.1 |
| Coordinates | 3419745..3420113 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS16430 (3416860) | 3416860..3417055 | + | 196 | Protein_3210 | DUF905 family protein | - |
| LQ128_RS16435 (3417173) | 3417173..3417991 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| LQ128_RS16440 (3418333) | 3418333..3418806 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| LQ128_RS16445 (3418822) | 3418822..3419298 | + | 477 | WP_001186775.1 | RadC family protein | - |
| LQ128_RS16450 (3419361) | 3419361..3419582 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ128_RS16455 (3419745) | 3419745..3420113 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ128_RS16460 (3420203) | 3420203..3420580 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| LQ128_RS16465 (3420577) | 3420577..3421065 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| LQ128_RS16470 (3421082) | 3421082..3421258 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| LQ128_RS16475 (3421364) | 3421364..3421513 | + | 150 | Protein_3219 | hypothetical protein | - |
| LQ128_RS26555 (3421880) | 3421880..3422185 | + | 306 | Protein_3220 | helix-turn-helix domain-containing protein | - |
| LQ128_RS16485 (3422847) | 3422847..3424469 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3406050..3433536 | 27486 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T296519 WP_000854759.1 NZ_OX030701:3420203-3420580 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT296519 WP_001295723.1 NZ_OX030701:3419745-3420113 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |