Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2391829..2392629 | Replicon | chromosome |
Accession | NZ_OX030701 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | LQ128_RS11665 | Protein ID | WP_000342452.1 |
Coordinates | 2391829..2392356 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | LQ128_RS11670 | Protein ID | WP_001277107.1 |
Coordinates | 2392363..2392629 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ128_RS11640 (2386905) | 2386905..2387672 | - | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
LQ128_RS11645 (2387669) | 2387669..2388946 | - | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
LQ128_RS11650 (2388943) | 2388943..2389869 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
LQ128_RS11655 (2389917) | 2389917..2391026 | - | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
LQ128_RS11660 (2391449) | 2391449..2391832 | + | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
LQ128_RS11665 (2391829) | 2391829..2392356 | - | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
LQ128_RS11670 (2392363) | 2392363..2392629 | - | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
LQ128_RS11675 (2392778) | 2392778..2393881 | - | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
LQ128_RS11680 (2394152) | 2394152..2395006 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
LQ128_RS11685 (2395251) | 2395251..2396309 | - | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
LQ128_RS11690 (2396302) | 2396302..2396970 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T296515 WP_000342452.1 NZ_OX030701:c2392356-2391829 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |