296512

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1858589..1859423 Replicon chromosome
Accession NZ_OX030701
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag LQ128_RS08990 Protein ID WP_000854690.1
Coordinates 1859046..1859423 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag LQ128_RS08985 Protein ID WP_001305076.1
Coordinates 1858589..1858957 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ128_RS08945 (1853671) 1853671..1854798 + 1128 Protein_1757 hypothetical protein -
LQ128_RS08950 (1854874) 1854874..1855329 + 456 WP_000581502.1 IrmA family protein -
LQ128_RS08955 (1855408) 1855408..1855641 + 234 WP_000902034.1 DUF905 family protein -
LQ128_RS08960 (1855742) 1855742..1856560 + 819 WP_001234620.1 DUF932 domain-containing protein -
LQ128_RS08965 (1856615) 1856615..1857100 + 486 WP_000849565.1 antirestriction protein -
LQ128_RS08970 (1857116) 1857116..1857592 + 477 WP_001186726.1 RadC family protein -
LQ128_RS08975 (1857655) 1857655..1857876 + 222 WP_000692329.1 DUF987 domain-containing protein -
LQ128_RS08980 (1857895) 1857895..1858539 + 645 WP_000094916.1 hypothetical protein -
LQ128_RS08985 (1858589) 1858589..1858957 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ128_RS08990 (1859046) 1859046..1859423 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
LQ128_RS08995 (1859420) 1859420..1859908 + 489 WP_000761699.1 DUF5983 family protein -
LQ128_RS09000 (1859925) 1859925..1860122 + 198 WP_000839293.1 DUF957 domain-containing protein -
LQ128_RS09005 (1860207) 1860207..1861052 + 846 WP_001529401.1 DUF4942 domain-containing protein -
LQ128_RS09010 (1861121) 1861121..1861516 + 396 WP_000208384.1 DUF6088 family protein -
LQ128_RS09015 (1861509) 1861509..1862442 + 934 Protein_1771 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
LQ128_RS09020 (1862859) 1862859..1863029 + 171 Protein_1772 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 1858589..1880632 22043
- flank IS/Tn - - 1862874..1863029 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T296512 WP_000854690.1 NZ_OX030701:1859046-1859423 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT296512 WP_001305076.1 NZ_OX030701:1858589-1858957 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References