Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1858589..1859423 | Replicon | chromosome |
| Accession | NZ_OX030701 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | LQ128_RS08990 | Protein ID | WP_000854690.1 |
| Coordinates | 1859046..1859423 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | LQ128_RS08985 | Protein ID | WP_001305076.1 |
| Coordinates | 1858589..1858957 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS08945 (1853671) | 1853671..1854798 | + | 1128 | Protein_1757 | hypothetical protein | - |
| LQ128_RS08950 (1854874) | 1854874..1855329 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| LQ128_RS08955 (1855408) | 1855408..1855641 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| LQ128_RS08960 (1855742) | 1855742..1856560 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| LQ128_RS08965 (1856615) | 1856615..1857100 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| LQ128_RS08970 (1857116) | 1857116..1857592 | + | 477 | WP_001186726.1 | RadC family protein | - |
| LQ128_RS08975 (1857655) | 1857655..1857876 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| LQ128_RS08980 (1857895) | 1857895..1858539 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| LQ128_RS08985 (1858589) | 1858589..1858957 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ128_RS08990 (1859046) | 1859046..1859423 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| LQ128_RS08995 (1859420) | 1859420..1859908 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| LQ128_RS09000 (1859925) | 1859925..1860122 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| LQ128_RS09005 (1860207) | 1860207..1861052 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| LQ128_RS09010 (1861121) | 1861121..1861516 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| LQ128_RS09015 (1861509) | 1861509..1862442 | + | 934 | Protein_1771 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| LQ128_RS09020 (1862859) | 1862859..1863029 | + | 171 | Protein_1772 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT | 1858589..1880632 | 22043 | |
| - | flank | IS/Tn | - | - | 1862874..1863029 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T296512 WP_000854690.1 NZ_OX030701:1859046-1859423 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT296512 WP_001305076.1 NZ_OX030701:1858589-1858957 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|