296509

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 778606..779437 Replicon chromosome
Accession NZ_OX030701
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag LQ128_RS03990 Protein ID WP_000854815.1
Coordinates 779063..779437 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag LQ128_RS03985 Protein ID WP_001280918.1
Coordinates 778606..778974 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ128_RS03940 (773695) 773695..774441 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
LQ128_RS03945 (774524) 774524..774874 + 351 Protein_779 hypothetical protein -
LQ128_RS03950 (774890) 774890..775300 + 411 WP_000846703.1 hypothetical protein -
LQ128_RS03955 (775521) 775521..776339 + 819 WP_001542275.1 DUF932 domain-containing protein -
LQ128_RS03960 (776339) 776339..776584 + 246 WP_001164966.1 hypothetical protein -
LQ128_RS03965 (776678) 776678..777151 + 474 WP_001542276.1 antirestriction protein -
LQ128_RS03970 (777167) 777167..777643 + 477 WP_001186200.1 RadC family protein -
LQ128_RS03975 (777706) 777706..777927 + 222 WP_000692345.1 DUF987 domain-containing protein -
LQ128_RS03980 (777946) 777946..778590 + 645 WP_000086752.1 hypothetical protein -
LQ128_RS03985 (778606) 778606..778974 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ128_RS03990 (779063) 779063..779437 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LQ128_RS03995 (779434) 779434..779628 + 195 WP_000988600.1 DUF5983 family protein -
LQ128_RS04000 (779674) 779674..779754 + 81 Protein_790 hypothetical protein -
LQ128_RS04005 (780043) 780043..780123 - 81 WP_023441679.1 hypothetical protein -
LQ128_RS04010 (780102) 780102..780425 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
LQ128_RS04015 (780526) 780526..780855 - 330 WP_000450409.1 DUF496 family protein -
LQ128_RS04020 (781027) 781027..782085 - 1059 WP_001200889.1 FUSC family protein -
LQ128_RS04025 (782283) 782283..782756 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
LQ128_RS04030 (782875) 782875..784041 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T296509 WP_000854815.1 NZ_OX030701:779063-779437 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT296509 WP_001280918.1 NZ_OX030701:778606-778974 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References