Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 778606..779437 | Replicon | chromosome |
| Accession | NZ_OX030701 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | LQ128_RS03990 | Protein ID | WP_000854815.1 |
| Coordinates | 779063..779437 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | LQ128_RS03985 | Protein ID | WP_001280918.1 |
| Coordinates | 778606..778974 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS03940 (773695) | 773695..774441 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ128_RS03945 (774524) | 774524..774874 | + | 351 | Protein_779 | hypothetical protein | - |
| LQ128_RS03950 (774890) | 774890..775300 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| LQ128_RS03955 (775521) | 775521..776339 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| LQ128_RS03960 (776339) | 776339..776584 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| LQ128_RS03965 (776678) | 776678..777151 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| LQ128_RS03970 (777167) | 777167..777643 | + | 477 | WP_001186200.1 | RadC family protein | - |
| LQ128_RS03975 (777706) | 777706..777927 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ128_RS03980 (777946) | 777946..778590 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| LQ128_RS03985 (778606) | 778606..778974 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ128_RS03990 (779063) | 779063..779437 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| LQ128_RS03995 (779434) | 779434..779628 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| LQ128_RS04000 (779674) | 779674..779754 | + | 81 | Protein_790 | hypothetical protein | - |
| LQ128_RS04005 (780043) | 780043..780123 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| LQ128_RS04010 (780102) | 780102..780425 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
| LQ128_RS04015 (780526) | 780526..780855 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| LQ128_RS04020 (781027) | 781027..782085 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
| LQ128_RS04025 (782283) | 782283..782756 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| LQ128_RS04030 (782875) | 782875..784041 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T296509 WP_000854815.1 NZ_OX030701:779063-779437 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |