Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 21986..22629 Replicon plasmid P2
Accession NZ_OW970562
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV17_RS26930 Protein ID WP_015063455.1
Coordinates 21986..22402 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV17_RS26935 Protein ID WP_001261276.1
Coordinates 22399..22629 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV17_RS26910 (AI2766V1_5107) 17374..18930 + 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -
LQV17_RS26915 (AI2766V1_REPA000000091) 19233..19511 - 279 Protein_22 IS3 family transposase -
LQV17_RS26920 (AI2766V1_5109) 19528..20604 - 1077 WP_000227969.1 IS110 family transposase -
LQV17_RS26925 (AI2766V1_REPA000000093) 20886..21742 - 857 Protein_24 IS3-like element ISEc15 family transposase -
LQV17_RS26930 (AI2766V1_5112) 21986..22402 - 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV17_RS26935 (AI2766V1_5113) 22399..22629 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV17_RS26940 (AI2766V1_5114) 23203..23553 + 351 WP_000493378.1 hypothetical protein -
LQV17_RS26945 (AI2766V1_5115) 23604..24347 + 744 WP_000129823.1 hypothetical protein -
LQV17_RS26950 (AI2766V1_5116) 24344..25120 + 777 WP_000015958.1 site-specific integrase -
LQV17_RS26955 (AI2766V1_5117) 25178..25435 - 258 WP_000764642.1 hypothetical protein -
LQV17_RS26960 25564..25668 - 105 WP_032409716.1 hypothetical protein -
LQV17_RS26965 (AI2766V1_5118) 26203..27069 + 867 WP_004118283.1 replication initiation protein -
LQV17_RS26970 (AI2766V1_5119) 27246..27515 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / dfrA14 / qacE / sul1 / mph(A) / blaCTX-M-15 / dfrA12 / aph(3')-Ia - 1..65762 65762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296503 WP_015063455.1 NZ_OW970562:c22402-21986 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296503 WP_001261276.1 NZ_OW970562:c22629-22399 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References