Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 116309..116832 Replicon plasmid P1
Accession NZ_OW970561
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LQV17_RS26775 Protein ID WP_015632464.1
Coordinates 116309..116614 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LQV17_RS26780 Protein ID WP_015632465.1
Coordinates 116614..116832 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV17_RS26730 (AI2766V1_5076) 111339..111767 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LQV17_RS26735 (AI2766V1_5077) 111760..112740 - 981 WP_015632457.1 plasmid segregation protein ParM -
LQV17_RS26740 (AI2766V1_5078) 113101..113283 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LQV17_RS26745 (AI2766V1_5079) 113309..113752 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LQV17_RS26750 113958..114080 - 123 Protein_120 transcriptional regulator -
LQV17_RS26755 (AI2766V1_5081) 114094..114321 - 228 WP_016162072.1 hypothetical protein -
LQV17_RS26760 114553..115008 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LQV17_RS26765 115260..115355 - 96 Protein_123 IS1 family transposase -
LQV17_RS26770 (AI2766V1_5084) 115820..116197 - 378 WP_016162069.1 hypothetical protein -
LQV17_RS26775 (AI2766V1_5085) 116309..116614 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV17_RS26780 (AI2766V1_5086) 116614..116832 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV17_RS26785 (AI2766V1_5087) 117018..118043 + 1026 WP_015632466.1 IS110 family transposase -
LQV17_RS26790 (AI2766V1_REPA000000041) 118338..118823 + 486 Protein_128 IS5 family transposase -
LQV17_RS26795 (AI2766V1_5088) 118987..119418 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LQV17_RS26800 (AI2766V1_5089) 119418..120689 + 1272 WP_229984405.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtF / ARR-3 - 1..121082 121082


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T296502 WP_015632464.1 NZ_OW970561:c116614-116309 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT296502 WP_015632465.1 NZ_OW970561:c116832-116614 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References