Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4163074..4163693 Replicon chromosome
Accession NZ_OW970560
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV17_RS20350 Protein ID WP_002892050.1
Coordinates 4163475..4163693 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV17_RS20345 Protein ID WP_002892066.1
Coordinates 4163074..4163448 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV17_RS20335 (4158226) 4158226..4159419 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV17_RS20340 (4159442) 4159442..4162588 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV17_RS20345 (4163074) 4163074..4163448 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV17_RS20350 (4163475) 4163475..4163693 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV17_RS20355 (4163856) 4163856..4164422 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV17_RS20360 (4164394) 4164394..4164534 - 141 WP_004147370.1 hypothetical protein -
LQV17_RS20365 (4164555) 4164555..4165025 + 471 WP_020802585.1 YlaC family protein -
LQV17_RS20370 (4165000) 4165000..4166451 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV17_RS20375 (4166552) 4166552..4167250 + 699 WP_023287311.1 GNAT family protein -
LQV17_RS20380 (4167247) 4167247..4167387 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV17_RS20385 (4167387) 4167387..4167650 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296498 WP_002892050.1 NZ_OW970560:4163475-4163693 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296498 WP_002892066.1 NZ_OW970560:4163074-4163448 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References