Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1640581..1641317 | Replicon | chromosome |
Accession | NZ_OW970560 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | LQV17_RS08150 | Protein ID | WP_032433360.1 |
Coordinates | 1640835..1641317 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | LQV17_RS08145 | Protein ID | WP_003026799.1 |
Coordinates | 1640581..1640847 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV17_RS08120 (1636227) | 1636227..1637366 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
LQV17_RS08125 (1637395) | 1637395..1638057 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
LQV17_RS08130 (1638038) | 1638038..1639045 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
LQV17_RS08135 (1639063) | 1639063..1639695 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
LQV17_RS08140 (1639705) | 1639705..1640268 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
LQV17_RS08145 (1640581) | 1640581..1640847 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
LQV17_RS08150 (1640835) | 1640835..1641317 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
LQV17_RS08155 (1641517) | 1641517..1642920 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
LQV17_RS08160 (1642949) | 1642949..1643581 | - | 633 | WP_060591614.1 | hypothetical protein | - |
LQV17_RS08165 (1643961) | 1643961..1644560 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
LQV17_RS08170 (1644773) | 1644773..1645717 | - | 945 | WP_077254249.1 | fimbrial protein | - |
LQV17_RS08175 (1645729) | 1645729..1645989 | - | 261 | WP_035588053.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1610804..1654392 | 43588 | |
- | flank | IS/Tn | - | - | 1641517..1642920 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T296492 WP_032433360.1 NZ_OW970560:1640835-1641317 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |