Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1623890..1624533 | Replicon | chromosome |
| Accession | NZ_OW970560 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | LQV17_RS08055 | Protein ID | WP_032433387.1 |
| Coordinates | 1624117..1624533 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV17_RS08050 | Protein ID | WP_001261276.1 |
| Coordinates | 1623890..1624120 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV17_RS08035 (1618912) | 1618912..1619999 | + | 1088 | Protein_1570 | transcriptional repressor PifC | - |
| LQV17_RS08040 (1620002) | 1620002..1622242 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| LQV17_RS08045 (1622770) | 1622770..1623585 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| LQV17_RS08050 (1623890) | 1623890..1624120 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV17_RS08055 (1624117) | 1624117..1624533 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV17_RS08060 (1624689) | 1624689..1625669 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| LQV17_RS08065 (1625864) | 1625864..1627435 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| LQV17_RS08070 (1627754) | 1627754..1628002 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| LQV17_RS08075 (1628061) | 1628061..1628579 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| LQV17_RS08080 (1628610) | 1628610..1629101 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| LQV17_RS08085 (1629161) | 1629161..1629364 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1610804..1654392 | 43588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296491 WP_032433387.1 NZ_OW970560:1624117-1624533 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |