Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 49224..49867 Replicon plasmid P2
Accession NZ_OW970555
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV20_RS26895 Protein ID WP_015063455.1
Coordinates 49224..49640 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV20_RS26900 Protein ID WP_001261276.1
Coordinates 49637..49867 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV20_RS26875 (AI2768V1_5093) 44612..46168 + 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -
LQV20_RS26880 (AI2768V1_REPA000000083) 46471..46749 - 279 Protein_52 IS3 family transposase -
LQV20_RS26885 (AI2768V1_5095) 46766..47842 - 1077 WP_000227969.1 IS110 family transposase -
LQV20_RS26890 (AI2768V1_REPA000000085) 48124..48980 - 857 Protein_54 IS3-like element ISEc15 family transposase -
LQV20_RS26895 (AI2768V1_5098) 49224..49640 - 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV20_RS26900 (AI2768V1_5099) 49637..49867 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV20_RS26905 (AI2768V1_5100) 50441..50791 + 351 WP_000493378.1 hypothetical protein -
LQV20_RS26910 (AI2768V1_5101) 50842..51585 + 744 WP_000129823.1 hypothetical protein -
LQV20_RS26915 (AI2768V1_5102) 51582..52358 + 777 WP_000015958.1 site-specific integrase -
LQV20_RS26920 (AI2768V1_5103) 52416..52673 - 258 WP_000764642.1 hypothetical protein -
LQV20_RS26925 52802..52906 - 105 WP_032409716.1 hypothetical protein -
LQV20_RS26930 (AI2768V1_5104) 53441..54307 + 867 WP_004118283.1 replication initiation protein -
LQV20_RS26935 (AI2768V1_5105) 54484..54753 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-15 / dfrA12 / aph(3')-Ia / qnrB1 / dfrA14 / qacE / sul1 / mph(A) - 1..65762 65762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296484 WP_015063455.1 NZ_OW970555:c49640-49224 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296484 WP_001261276.1 NZ_OW970555:c49867-49637 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References