Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4038781..4039400 Replicon chromosome
Accession NZ_OW970553
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV20_RS19725 Protein ID WP_002892050.1
Coordinates 4039182..4039400 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV20_RS19720 Protein ID WP_002892066.1
Coordinates 4038781..4039155 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV20_RS19710 (4033933) 4033933..4035126 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV20_RS19715 (4035149) 4035149..4038295 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV20_RS19720 (4038781) 4038781..4039155 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV20_RS19725 (4039182) 4039182..4039400 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV20_RS19730 (4039563) 4039563..4040129 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV20_RS19735 (4040101) 4040101..4040241 - 141 WP_004147370.1 hypothetical protein -
LQV20_RS19740 (4040262) 4040262..4040732 + 471 WP_020802585.1 YlaC family protein -
LQV20_RS19745 (4040707) 4040707..4042158 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV20_RS19750 (4042259) 4042259..4042957 + 699 WP_023287311.1 GNAT family protein -
LQV20_RS19755 (4042954) 4042954..4043094 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV20_RS19760 (4043094) 4043094..4043357 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296478 WP_002892050.1 NZ_OW970553:4039182-4039400 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296478 WP_002892066.1 NZ_OW970553:4038781-4039155 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References