Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 834115..834772 | Replicon | chromosome |
Accession | NZ_OW970553 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | LQV20_RS04175 | Protein ID | WP_002916310.1 |
Coordinates | 834362..834772 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | LQV20_RS04170 | Protein ID | WP_002916312.1 |
Coordinates | 834115..834381 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV20_RS04145 (829271) | 829271..830704 | - | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
LQV20_RS04150 (830823) | 830823..831551 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
LQV20_RS04155 (831601) | 831601..831912 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
LQV20_RS04160 (832076) | 832076..832735 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
LQV20_RS04165 (832886) | 832886..833869 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
LQV20_RS04170 (834115) | 834115..834381 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
LQV20_RS04175 (834362) | 834362..834772 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
LQV20_RS04180 (834779) | 834779..835300 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
LQV20_RS04185 (835401) | 835401..836297 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
LQV20_RS04190 (836320) | 836320..837033 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQV20_RS04195 (837039) | 837039..838772 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T296470 WP_002916310.1 NZ_OW970553:834362-834772 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |