Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 9662..10305 Replicon plasmid P2
Accession NZ_OW970542
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV19_RS26530 Protein ID WP_015063455.1
Coordinates 9662..10078 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV19_RS26535 Protein ID WP_001261276.1
Coordinates 10075..10305 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV19_RS26510 (AI2993V1_5037) 5050..6606 + 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -
LQV19_RS26515 (AI2993V1_REPA000000085) 6909..7187 - 279 Protein_7 IS3 family transposase -
LQV19_RS26520 (AI2993V1_5039) 7204..8280 - 1077 WP_000227969.1 IS110 family transposase -
LQV19_RS26525 (AI2993V1_REPA000000087) 8562..9418 - 857 Protein_9 IS3-like element ISEc15 family transposase -
LQV19_RS26530 (AI2993V1_5042) 9662..10078 - 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV19_RS26535 (AI2993V1_5043) 10075..10305 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV19_RS26540 (AI2993V1_5044) 10879..11229 + 351 WP_000493378.1 hypothetical protein -
LQV19_RS26545 (AI2993V1_5045) 11280..12023 + 744 WP_000129823.1 hypothetical protein -
LQV19_RS26550 (AI2993V1_5046) 12020..12796 + 777 WP_000015958.1 site-specific integrase -
LQV19_RS26555 (AI2993V1_5047) 12854..13111 - 258 WP_000764642.1 hypothetical protein -
LQV19_RS26560 13240..13344 - 105 WP_032409716.1 hypothetical protein -
LQV19_RS26565 (AI2993V1_5048) 13879..14745 + 867 WP_004118283.1 replication initiation protein -
LQV19_RS26570 (AI2993V1_5049) 14922..15191 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / blaCTX-M-15 / ARR-3 / rmtF / dfrA12 - 1..74813 74813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296467 WP_015063455.1 NZ_OW970542:c10078-9662 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296467 WP_001261276.1 NZ_OW970542:c10305-10075 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References