Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 96694..97217 Replicon plasmid P1
Accession NZ_OW970541
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LQV19_RS26450 Protein ID WP_015632464.1
Coordinates 96694..96999 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LQV19_RS26455 Protein ID WP_015632465.1
Coordinates 96999..97217 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV19_RS26405 (AI2993V1_5018) 91724..92152 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LQV19_RS26410 (AI2993V1_5019) 92145..93125 - 981 WP_015632457.1 plasmid segregation protein ParM -
LQV19_RS26415 (AI2993V1_5020) 93486..93668 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LQV19_RS26420 (AI2993V1_5021) 93694..94137 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LQV19_RS26425 94343..94465 - 123 Protein_98 transcriptional regulator -
LQV19_RS26430 (AI2993V1_5023) 94479..94706 - 228 WP_016162072.1 hypothetical protein -
LQV19_RS26435 94938..95393 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LQV19_RS26440 95645..95740 - 96 Protein_101 IS1 family transposase -
LQV19_RS26445 (AI2993V1_5026) 96205..96582 - 378 WP_016162069.1 hypothetical protein -
LQV19_RS26450 (AI2993V1_5027) 96694..96999 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV19_RS26455 (AI2993V1_5028) 96999..97217 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV19_RS26460 (AI2993V1_5029) 97403..98428 + 1026 WP_015632466.1 IS110 family transposase -
LQV19_RS26465 (AI2993V1_REPA000000040) 98723..99208 + 486 Protein_106 IS5 family transposase -
LQV19_RS26470 (AI2993V1_5030) 99372..99803 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LQV19_RS26475 (AI2993V1_5031) 99803..101074 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..101467 101467


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T296466 WP_015632464.1 NZ_OW970541:c96999-96694 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT296466 WP_015632465.1 NZ_OW970541:c97217-96999 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References