Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4028494..4029113 | Replicon | chromosome |
| Accession | NZ_OW970540 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQV19_RS19700 | Protein ID | WP_002892050.1 |
| Coordinates | 4028895..4029113 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | LQV19_RS19695 | Protein ID | WP_002892066.1 |
| Coordinates | 4028494..4028868 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV19_RS19685 (4023646) | 4023646..4024839 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQV19_RS19690 (4024862) | 4024862..4028008 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQV19_RS19695 (4028494) | 4028494..4028868 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| LQV19_RS19700 (4028895) | 4028895..4029113 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQV19_RS19705 (4029276) | 4029276..4029842 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| LQV19_RS19710 (4029814) | 4029814..4029954 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| LQV19_RS19715 (4029975) | 4029975..4030445 | + | 471 | WP_020802585.1 | YlaC family protein | - |
| LQV19_RS19720 (4030420) | 4030420..4031871 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
| LQV19_RS19725 (4031972) | 4031972..4032670 | + | 699 | WP_023287311.1 | GNAT family protein | - |
| LQV19_RS19730 (4032667) | 4032667..4032807 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| LQV19_RS19735 (4032807) | 4032807..4033070 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296461 WP_002892050.1 NZ_OW970540:4028895-4029113 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT296461 WP_002892066.1 NZ_OW970540:4028494-4028868 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |