Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 16159..16802 Replicon plasmid P4
Accession NZ_OW970534
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV07_RS27355 Protein ID WP_015063455.1
Coordinates 16386..16802 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV07_RS27350 Protein ID WP_001261276.1
Coordinates 16159..16389 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV07_RS27315 (AI3065V1_5191) 11273..11542 + 270 WP_000339857.1 hypothetical protein -
LQV07_RS27320 (AI3065V1_5192) 11719..12585 - 867 WP_004118283.1 replication initiation protein -
LQV07_RS27325 13120..13224 + 105 WP_032409716.1 hypothetical protein -
LQV07_RS27330 (AI3065V1_5193) 13353..13610 + 258 WP_000764642.1 hypothetical protein -
LQV07_RS27335 (AI3065V1_5194) 13668..14444 - 777 WP_000015958.1 site-specific integrase -
LQV07_RS27340 (AI3065V1_5195) 14441..15184 - 744 WP_000129823.1 hypothetical protein -
LQV07_RS27345 (AI3065V1_5196) 15235..15585 - 351 WP_000493378.1 hypothetical protein -
LQV07_RS27350 (AI3065V1_5197) 16159..16389 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV07_RS27355 (AI3065V1_5198) 16386..16802 + 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV07_RS27360 (AI3065V1_REPA000000095) 17046..17902 + 857 Protein_19 IS3-like element ISEc15 family transposase -
LQV07_RS27365 (AI3065V1_5201) 18184..19260 + 1077 WP_000227969.1 IS110 family transposase -
LQV07_RS27370 (AI3065V1_REPA000000092) 19277..19555 + 279 Protein_21 IS3 family transposase -
LQV07_RS27375 (AI3065V1_5203) 19858..20934 - 1077 WP_072146639.1 HAMP domain-containing methyl-accepting chemotaxis protein -
LQV07_RS27380 (AI3065V1_5204) 21016..21720 - 705 WP_001067855.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA12 / blaCTX-M-15 - 1..44051 44051


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296450 WP_015063455.1 NZ_OW970534:16386-16802 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296450 WP_001261276.1 NZ_OW970534:16159-16389 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References