Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1501977..1502713 | Replicon | chromosome |
| Accession | NZ_OW970530 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | LQV07_RS07490 | Protein ID | WP_032433360.1 |
| Coordinates | 1502231..1502713 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LQV07_RS07485 | Protein ID | WP_003026799.1 |
| Coordinates | 1501977..1502243 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV07_RS07460 (1497623) | 1497623..1498762 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| LQV07_RS07465 (1498791) | 1498791..1499453 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| LQV07_RS07470 (1499434) | 1499434..1500441 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
| LQV07_RS07475 (1500459) | 1500459..1501091 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| LQV07_RS07480 (1501101) | 1501101..1501664 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| LQV07_RS07485 (1501977) | 1501977..1502243 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LQV07_RS07490 (1502231) | 1502231..1502713 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| LQV07_RS07495 (1502913) | 1502913..1504316 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| LQV07_RS07500 (1504345) | 1504345..1504977 | - | 633 | WP_060591614.1 | hypothetical protein | - |
| LQV07_RS07505 (1505357) | 1505357..1505956 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| LQV07_RS07510 (1506169) | 1506169..1507113 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| LQV07_RS07515 (1507125) | 1507125..1507385 | - | 261 | WP_035588053.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1472200..1515788 | 43588 | |
| - | flank | IS/Tn | - | - | 1502913..1504316 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T296438 WP_032433360.1 NZ_OW970530:1502231-1502713 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |