Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1485286..1485929 | Replicon | chromosome |
| Accession | NZ_OW970530 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | LQV07_RS07395 | Protein ID | WP_032433387.1 |
| Coordinates | 1485513..1485929 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV07_RS07390 | Protein ID | WP_001261276.1 |
| Coordinates | 1485286..1485516 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV07_RS07375 (1480308) | 1480308..1481395 | + | 1088 | Protein_1443 | transcriptional repressor PifC | - |
| LQV07_RS07380 (1481398) | 1481398..1483638 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| LQV07_RS07385 (1484166) | 1484166..1484981 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| LQV07_RS07390 (1485286) | 1485286..1485516 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV07_RS07395 (1485513) | 1485513..1485929 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV07_RS07400 (1486085) | 1486085..1487065 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| LQV07_RS07405 (1487260) | 1487260..1488831 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| LQV07_RS07410 (1489150) | 1489150..1489398 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| LQV07_RS07415 (1489457) | 1489457..1489975 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| LQV07_RS07420 (1490006) | 1490006..1490497 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| LQV07_RS07425 (1490557) | 1490557..1490760 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1472200..1515788 | 43588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296437 WP_032433387.1 NZ_OW970530:1485513-1485929 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |