Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 24002..24645 Replicon plasmid P3
Accession NZ_OW970517
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQ358_RS26915 Protein ID WP_015063455.1
Coordinates 24002..24418 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQ358_RS26920 Protein ID WP_001261276.1
Coordinates 24415..24645 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ358_RS26895 (AI2763V1_5099) 19390..20946 + 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -
LQ358_RS26900 (AI2763V1_REPA000000079) 21249..21527 - 279 Protein_27 IS3 family transposase -
LQ358_RS26905 (AI2763V1_5101) 21544..22620 - 1077 WP_000227969.1 IS110 family transposase -
LQ358_RS26910 (AI2763V1_REPA000000081) 22902..23758 - 857 Protein_29 IS3-like element ISEc15 family transposase -
LQ358_RS26915 (AI2763V1_5104) 24002..24418 - 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ358_RS26920 (AI2763V1_5105) 24415..24645 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ358_RS26925 (AI2763V1_5106) 25219..25569 + 351 WP_000493378.1 hypothetical protein -
LQ358_RS26930 (AI2763V1_5107) 25620..26363 + 744 WP_000129823.1 hypothetical protein -
LQ358_RS26935 (AI2763V1_5108) 26360..27136 + 777 WP_000015958.1 site-specific integrase -
LQ358_RS26940 (AI2763V1_5109) 27194..27451 - 258 WP_000764642.1 hypothetical protein -
LQ358_RS26945 27580..27684 - 105 WP_032409716.1 hypothetical protein -
LQ358_RS26950 (AI2763V1_5110) 28219..29085 + 867 WP_004118283.1 replication initiation protein -
LQ358_RS26955 (AI2763V1_5111) 29262..29531 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA12 / mph(A) / blaCTX-M-15 - 1..52932 52932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296433 WP_015063455.1 NZ_OW970517:c24418-24002 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296433 WP_001261276.1 NZ_OW970517:c24645-24415 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References