Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4742157..4742673 | Replicon | chromosome |
Accession | NZ_OW970514 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | LQ358_RS23130 | Protein ID | WP_009486548.1 |
Coordinates | 4742157..4742441 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | LQ358_RS23135 | Protein ID | WP_002886901.1 |
Coordinates | 4742431..4742673 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ358_RS23105 (4737574) | 4737574..4737837 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
LQ358_RS23110 (4737967) | 4737967..4738140 | + | 174 | WP_032433782.1 | hypothetical protein | - |
LQ358_RS23115 (4738143) | 4738143..4738886 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
LQ358_RS23120 (4739243) | 4739243..4741381 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
LQ358_RS23125 (4741689) | 4741689..4742153 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
LQ358_RS23130 (4742157) | 4742157..4742441 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ358_RS23135 (4742431) | 4742431..4742673 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LQ358_RS23140 (4742751) | 4742751..4744661 | - | 1911 | WP_229976683.1 | PRD domain-containing protein | - |
LQ358_RS23145 (4744684) | 4744684..4745838 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
LQ358_RS23150 (4745905) | 4745905..4746645 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T296429 WP_009486548.1 NZ_OW970514:c4742441-4742157 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |