Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1502344..1503080 | Replicon | chromosome |
| Accession | NZ_OW970514 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | LQ358_RS07490 | Protein ID | WP_032433360.1 |
| Coordinates | 1502598..1503080 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LQ358_RS07485 | Protein ID | WP_003026799.1 |
| Coordinates | 1502344..1502610 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ358_RS07460 (1497990) | 1497990..1499129 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| LQ358_RS07465 (1499158) | 1499158..1499820 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| LQ358_RS07470 (1499801) | 1499801..1500808 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
| LQ358_RS07475 (1500826) | 1500826..1501458 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| LQ358_RS07480 (1501468) | 1501468..1502031 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| LQ358_RS07485 (1502344) | 1502344..1502610 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ358_RS07490 (1502598) | 1502598..1503080 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| LQ358_RS07495 (1503280) | 1503280..1504683 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| LQ358_RS07500 (1504712) | 1504712..1505344 | - | 633 | WP_060591614.1 | hypothetical protein | - |
| LQ358_RS07505 (1505724) | 1505724..1506323 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| LQ358_RS07510 (1506536) | 1506536..1507480 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| LQ358_RS07515 (1507492) | 1507492..1507752 | - | 261 | WP_035588053.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1472567..1516155 | 43588 | |
| - | flank | IS/Tn | - | - | 1503280..1504683 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T296421 WP_032433360.1 NZ_OW970514:1502598-1503080 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |