Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5202815..5203440 | Replicon | chromosome |
| Accession | NZ_OW970492 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | LQV37_RS25370 | Protein ID | WP_002882817.1 |
| Coordinates | 5202815..5203198 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | LQV37_RS25375 | Protein ID | WP_004150355.1 |
| Coordinates | 5203198..5203440 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV37_RS25355 (5200181) | 5200181..5201083 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| LQV37_RS25360 (5201080) | 5201080..5201715 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQV37_RS25365 (5201712) | 5201712..5202641 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| LQV37_RS25370 (5202815) | 5202815..5203198 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV37_RS25375 (5203198) | 5203198..5203440 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| LQV37_RS25380 (5203645) | 5203645..5204562 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
| LQV37_RS25385 (5204576) | 5204576..5205517 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| LQV37_RS25390 (5205562) | 5205562..5205999 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| LQV37_RS25395 (5205996) | 5205996..5206856 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| LQV37_RS25400 (5206850) | 5206850..5207449 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T296414 WP_002882817.1 NZ_OW970492:c5203198-5202815 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |