Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1496523..1497166 | Replicon | chromosome |
| Accession | NZ_OW970492 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | LQV37_RS07445 | Protein ID | WP_032433387.1 |
| Coordinates | 1496750..1497166 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV37_RS07440 | Protein ID | WP_001261276.1 |
| Coordinates | 1496523..1496753 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV37_RS07425 (1491545) | 1491545..1492632 | + | 1088 | Protein_1453 | transcriptional repressor PifC | - |
| LQV37_RS07430 (1492635) | 1492635..1494875 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| LQV37_RS07435 (1495403) | 1495403..1496218 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| LQV37_RS07440 (1496523) | 1496523..1496753 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV37_RS07445 (1496750) | 1496750..1497166 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV37_RS07450 (1497322) | 1497322..1498302 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| LQV37_RS07455 (1498497) | 1498497..1500068 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| LQV37_RS07460 (1500387) | 1500387..1500635 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| LQV37_RS07465 (1500694) | 1500694..1501212 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| LQV37_RS07470 (1501243) | 1501243..1501734 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| LQV37_RS07475 (1501794) | 1501794..1501997 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1483437..1528579 | 45142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296404 WP_032433387.1 NZ_OW970492:1496750-1497166 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |