Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4117292..4117911 | Replicon | chromosome |
| Accession | NZ_OW970486 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQV31_RS20205 | Protein ID | WP_002892050.1 |
| Coordinates | 4117693..4117911 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | LQV31_RS20200 | Protein ID | WP_002892066.1 |
| Coordinates | 4117292..4117666 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV31_RS20190 (4112444) | 4112444..4113637 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQV31_RS20195 (4113660) | 4113660..4116806 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQV31_RS20200 (4117292) | 4117292..4117666 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| LQV31_RS20205 (4117693) | 4117693..4117911 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQV31_RS20210 (4118074) | 4118074..4118640 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| LQV31_RS20215 (4118612) | 4118612..4118752 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| LQV31_RS20220 (4118773) | 4118773..4119243 | + | 471 | WP_020802585.1 | YlaC family protein | - |
| LQV31_RS20225 (4119218) | 4119218..4120669 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
| LQV31_RS20230 (4120770) | 4120770..4121468 | + | 699 | WP_023287311.1 | GNAT family protein | - |
| LQV31_RS20235 (4121465) | 4121465..4121605 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| LQV31_RS20240 (4121605) | 4121605..4121868 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296396 WP_002892050.1 NZ_OW970486:4117693-4117911 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT296396 WP_002892066.1 NZ_OW970486:4117292-4117666 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |