Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4117292..4117911 Replicon chromosome
Accession NZ_OW970486
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV31_RS20205 Protein ID WP_002892050.1
Coordinates 4117693..4117911 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV31_RS20200 Protein ID WP_002892066.1
Coordinates 4117292..4117666 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV31_RS20190 (4112444) 4112444..4113637 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV31_RS20195 (4113660) 4113660..4116806 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV31_RS20200 (4117292) 4117292..4117666 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV31_RS20205 (4117693) 4117693..4117911 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV31_RS20210 (4118074) 4118074..4118640 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV31_RS20215 (4118612) 4118612..4118752 - 141 WP_004147370.1 hypothetical protein -
LQV31_RS20220 (4118773) 4118773..4119243 + 471 WP_020802585.1 YlaC family protein -
LQV31_RS20225 (4119218) 4119218..4120669 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV31_RS20230 (4120770) 4120770..4121468 + 699 WP_023287311.1 GNAT family protein -
LQV31_RS20235 (4121465) 4121465..4121605 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV31_RS20240 (4121605) 4121605..4121868 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296396 WP_002892050.1 NZ_OW970486:4117693-4117911 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296396 WP_002892066.1 NZ_OW970486:4117292-4117666 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References