Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1513093..1513829 | Replicon | chromosome |
| Accession | NZ_OW970486 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | LQV31_RS07530 | Protein ID | WP_032433360.1 |
| Coordinates | 1513347..1513829 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LQV31_RS07525 | Protein ID | WP_003026799.1 |
| Coordinates | 1513093..1513359 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV31_RS07500 (1508739) | 1508739..1509878 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| LQV31_RS07505 (1509907) | 1509907..1510569 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| LQV31_RS07510 (1510550) | 1510550..1511557 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
| LQV31_RS07515 (1511575) | 1511575..1512207 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| LQV31_RS07520 (1512217) | 1512217..1512780 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| LQV31_RS07525 (1513093) | 1513093..1513359 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LQV31_RS07530 (1513347) | 1513347..1513829 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| LQV31_RS07535 (1514190) | 1514190..1514789 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| LQV31_RS07540 (1515002) | 1515002..1515946 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| LQV31_RS07545 (1515958) | 1515958..1516218 | - | 261 | WP_035588053.1 | hypothetical protein | - |
| LQV31_RS07550 (1516389) | 1516389..1517129 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1483316..1524621 | 41305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T296390 WP_032433360.1 NZ_OW970486:1513347-1513829 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |