Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1496402..1497045 | Replicon | chromosome |
| Accession | NZ_OW970486 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | LQV31_RS07435 | Protein ID | WP_032433387.1 |
| Coordinates | 1496629..1497045 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV31_RS07430 | Protein ID | WP_001261276.1 |
| Coordinates | 1496402..1496632 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV31_RS07415 (1491424) | 1491424..1492511 | + | 1088 | Protein_1452 | transcriptional repressor PifC | - |
| LQV31_RS07420 (1492514) | 1492514..1494754 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| LQV31_RS07425 (1495282) | 1495282..1496097 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| LQV31_RS07430 (1496402) | 1496402..1496632 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV31_RS07435 (1496629) | 1496629..1497045 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV31_RS07440 (1497201) | 1497201..1498181 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| LQV31_RS07445 (1498376) | 1498376..1499947 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| LQV31_RS07450 (1500266) | 1500266..1500514 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| LQV31_RS07455 (1500573) | 1500573..1501091 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| LQV31_RS07460 (1501122) | 1501122..1501613 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| LQV31_RS07465 (1501673) | 1501673..1501876 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1483316..1524621 | 41305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296389 WP_032433387.1 NZ_OW970486:1496629-1497045 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |