Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5229259..5229884 | Replicon | chromosome |
| Accession | NZ_OW970478 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | LQV36_RS25490 | Protein ID | WP_002882817.1 |
| Coordinates | 5229259..5229642 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | LQV36_RS25495 | Protein ID | WP_004150355.1 |
| Coordinates | 5229642..5229884 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV36_RS25475 (5226625) | 5226625..5227527 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| LQV36_RS25480 (5227524) | 5227524..5228159 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQV36_RS25485 (5228156) | 5228156..5229085 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| LQV36_RS25490 (5229259) | 5229259..5229642 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV36_RS25495 (5229642) | 5229642..5229884 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| LQV36_RS25500 (5230089) | 5230089..5231006 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
| LQV36_RS25505 (5231020) | 5231020..5231961 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| LQV36_RS25510 (5232006) | 5232006..5232443 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| LQV36_RS25515 (5232440) | 5232440..5233300 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| LQV36_RS25520 (5233294) | 5233294..5233893 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T296383 WP_002882817.1 NZ_OW970478:c5229642-5229259 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |