Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4757237..4757753 | Replicon | chromosome |
| Accession | NZ_OW970478 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | LQV36_RS23215 | Protein ID | WP_009486548.1 |
| Coordinates | 4757237..4757521 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | LQV36_RS23220 | Protein ID | WP_002886901.1 |
| Coordinates | 4757511..4757753 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV36_RS23190 (4752654) | 4752654..4752917 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| LQV36_RS23195 (4753047) | 4753047..4753220 | + | 174 | WP_032433782.1 | hypothetical protein | - |
| LQV36_RS23200 (4753223) | 4753223..4753966 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| LQV36_RS23205 (4754323) | 4754323..4756461 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQV36_RS23210 (4756769) | 4756769..4757233 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQV36_RS23215 (4757237) | 4757237..4757521 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQV36_RS23220 (4757511) | 4757511..4757753 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQV36_RS23225 (4757831) | 4757831..4759741 | - | 1911 | WP_229976683.1 | PRD domain-containing protein | - |
| LQV36_RS23230 (4759764) | 4759764..4760918 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| LQV36_RS23235 (4760985) | 4760985..4761725 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T296381 WP_009486548.1 NZ_OW970478:c4757521-4757237 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |