Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4025613..4026232 Replicon chromosome
Accession NZ_OW970478
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV36_RS19690 Protein ID WP_002892050.1
Coordinates 4026014..4026232 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV36_RS19685 Protein ID WP_002892066.1
Coordinates 4025613..4025987 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV36_RS19675 (4020765) 4020765..4021958 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV36_RS19680 (4021981) 4021981..4025127 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV36_RS19685 (4025613) 4025613..4025987 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV36_RS19690 (4026014) 4026014..4026232 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV36_RS19695 (4026395) 4026395..4026961 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV36_RS19700 (4026933) 4026933..4027073 - 141 WP_004147370.1 hypothetical protein -
LQV36_RS19705 (4027094) 4027094..4027564 + 471 WP_020802585.1 YlaC family protein -
LQV36_RS19710 (4027539) 4027539..4028990 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV36_RS19715 (4029091) 4029091..4029789 + 699 WP_023287311.1 GNAT family protein -
LQV36_RS19720 (4029786) 4029786..4029926 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV36_RS19725 (4029926) 4029926..4030189 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296379 WP_002892050.1 NZ_OW970478:4026014-4026232 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296379 WP_002892066.1 NZ_OW970478:4025613-4025987 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References