Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1485653..1486296 | Replicon | chromosome |
Accession | NZ_OW970478 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | LQV36_RS07395 | Protein ID | WP_032433387.1 |
Coordinates | 1485880..1486296 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | LQV36_RS07390 | Protein ID | WP_001261276.1 |
Coordinates | 1485653..1485883 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV36_RS07375 (1480675) | 1480675..1481762 | + | 1088 | Protein_1443 | transcriptional repressor PifC | - |
LQV36_RS07380 (1481765) | 1481765..1484005 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
LQV36_RS07385 (1484533) | 1484533..1485348 | - | 816 | WP_032433388.1 | hypothetical protein | - |
LQV36_RS07390 (1485653) | 1485653..1485883 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQV36_RS07395 (1485880) | 1485880..1486296 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQV36_RS07400 (1486452) | 1486452..1487432 | + | 981 | WP_032433385.1 | hypothetical protein | - |
LQV36_RS07405 (1487627) | 1487627..1489198 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
LQV36_RS07410 (1489517) | 1489517..1489765 | + | 249 | WP_032433382.1 | hypothetical protein | - |
LQV36_RS07415 (1489824) | 1489824..1490342 | + | 519 | WP_045326794.1 | hypothetical protein | - |
LQV36_RS07420 (1490373) | 1490373..1490864 | + | 492 | WP_032433378.1 | hypothetical protein | - |
LQV36_RS07425 (1490924) | 1490924..1491127 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1472567..1516155 | 43588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296372 WP_032433387.1 NZ_OW970478:1485880-1486296 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |