Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1817..2460 | Replicon | plasmid P3 |
| Accession | NZ_OW970455 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | R9WRW3 |
| Locus tag | LQV13_RS26935 | Protein ID | WP_015063455.1 |
| Coordinates | 1817..2233 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV13_RS26940 | Protein ID | WP_001261276.1 |
| Coordinates | 2230..2460 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV13_RS26930 (AI2767V1_REPA000000097) | 717..1573 | - | 857 | Protein_1 | IS3-like element ISEc15 family transposase | - |
| LQV13_RS26935 (AI2767V1_5122) | 1817..2233 | - | 417 | WP_015063455.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV13_RS26940 (AI2767V1_5123) | 2230..2460 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV13_RS26945 (AI2767V1_5124) | 3034..3384 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| LQV13_RS26950 (AI2767V1_5125) | 3435..4178 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| LQV13_RS26955 (AI2767V1_5126) | 4175..4951 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| LQV13_RS26960 (AI2767V1_5127) | 5009..5266 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| LQV13_RS26965 | 5395..5499 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| LQV13_RS26970 (AI2767V1_5128) | 6034..6900 | + | 867 | WP_004118283.1 | replication initiation protein | - |
| LQV13_RS26975 (AI2767V1_5129) | 7077..7346 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 / ARR-3 / rmtF / mph(A) | - | 1..58021 | 58021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15036.50 Da Isoelectric Point: 8.5440
>T296368 WP_015063455.1 NZ_OW970455:c2233-1817 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R9WRW3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |