Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 112876..113399 Replicon plasmid P1
Accession NZ_OW970453
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LQV13_RS26480 Protein ID WP_015632464.1
Coordinates 112876..113181 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LQV13_RS26485 Protein ID WP_015632465.1
Coordinates 113181..113399 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV13_RS26435 (AI2767V1_5021) 107906..108334 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LQV13_RS26440 (AI2767V1_5022) 108327..109307 - 981 WP_015632457.1 plasmid segregation protein ParM -
LQV13_RS26445 (AI2767V1_5023) 109668..109850 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LQV13_RS26450 (AI2767V1_5024) 109876..110319 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LQV13_RS26455 110525..110647 - 123 Protein_120 transcriptional regulator -
LQV13_RS26460 (AI2767V1_5026) 110661..110888 - 228 WP_016162072.1 hypothetical protein -
LQV13_RS26465 111120..111575 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LQV13_RS26470 111827..111922 - 96 Protein_123 IS1 family transposase -
LQV13_RS26475 (AI2767V1_5029) 112387..112764 - 378 WP_016162069.1 hypothetical protein -
LQV13_RS26480 (AI2767V1_5030) 112876..113181 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV13_RS26485 (AI2767V1_5031) 113181..113399 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV13_RS26490 (AI2767V1_5032) 113585..114610 + 1026 WP_015632466.1 IS110 family transposase -
LQV13_RS26495 (AI2767V1_REPA000000052) 114905..115390 + 486 Protein_128 IS5 family transposase -
LQV13_RS26500 (AI2767V1_5033) 115554..115985 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LQV13_RS26505 (AI2767V1_5034) 115985..117256 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA12 - 1..117649 117649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T296367 WP_015632464.1 NZ_OW970453:c113181-112876 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT296367 WP_015632465.1 NZ_OW970453:c113399-113181 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References