Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4025738..4026357 Replicon chromosome
Accession NZ_OW970452
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV13_RS19685 Protein ID WP_002892050.1
Coordinates 4026139..4026357 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV13_RS19680 Protein ID WP_002892066.1
Coordinates 4025738..4026112 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV13_RS19670 (4020890) 4020890..4022083 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV13_RS19675 (4022106) 4022106..4025252 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV13_RS19680 (4025738) 4025738..4026112 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV13_RS19685 (4026139) 4026139..4026357 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV13_RS19690 (4026520) 4026520..4027086 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV13_RS19695 (4027058) 4027058..4027198 - 141 WP_004147370.1 hypothetical protein -
LQV13_RS19700 (4027219) 4027219..4027689 + 471 WP_020802585.1 YlaC family protein -
LQV13_RS19705 (4027664) 4027664..4029115 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV13_RS19710 (4029216) 4029216..4029914 + 699 WP_023287311.1 GNAT family protein -
LQV13_RS19715 (4029911) 4029911..4030051 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV13_RS19720 (4030051) 4030051..4030314 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296362 WP_002892050.1 NZ_OW970452:4026139-4026357 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296362 WP_002892066.1 NZ_OW970452:4025738-4026112 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References