Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11854..12497 | Replicon | plasmid P2 |
| Accession | NZ_OW970438 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | R9WRW3 |
| Locus tag | LQV41_RS26690 | Protein ID | WP_015063455.1 |
| Coordinates | 12081..12497 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV41_RS26685 | Protein ID | WP_001261276.1 |
| Coordinates | 11854..12084 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV41_RS26650 (AI2765V1_5059) | 6968..7237 | + | 270 | WP_000339857.1 | hypothetical protein | - |
| LQV41_RS26655 (AI2765V1_5060) | 7414..8280 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| LQV41_RS26660 | 8815..8919 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| LQV41_RS26665 (AI2765V1_5061) | 9048..9305 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| LQV41_RS26670 (AI2765V1_5062) | 9363..10139 | - | 777 | WP_000015958.1 | site-specific integrase | - |
| LQV41_RS26675 (AI2765V1_5063) | 10136..10879 | - | 744 | WP_000129823.1 | hypothetical protein | - |
| LQV41_RS26680 (AI2765V1_5064) | 10930..11280 | - | 351 | WP_000493378.1 | hypothetical protein | - |
| LQV41_RS26685 (AI2765V1_5065) | 11854..12084 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV41_RS26690 (AI2765V1_5066) | 12081..12497 | + | 417 | WP_015063455.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV41_RS26695 (AI2765V1_REPA000000087) | 12741..13597 | + | 857 | Protein_15 | IS3-like element ISEc15 family transposase | - |
| LQV41_RS26700 (AI2765V1_5069) | 13879..14955 | + | 1077 | WP_000227969.1 | IS110 family transposase | - |
| LQV41_RS26705 (AI2765V1_REPA000000084) | 14972..15250 | + | 279 | Protein_17 | IS3 family transposase | - |
| LQV41_RS26710 (AI2765V1_5071) | 15553..17109 | - | 1557 | WP_053897648.1 | PAS domain-containing methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / sul1 / qacE / dfrA12 / aph(3')-Ia / qnrB1 / dfrA14 / blaCTX-M-15 | - | 1..64662 | 64662 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15036.50 Da Isoelectric Point: 8.5440
>T296336 WP_015063455.1 NZ_OW970438:12081-12497 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R9WRW3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |