Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11854..12497 Replicon plasmid P2
Accession NZ_OW970438
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV41_RS26690 Protein ID WP_015063455.1
Coordinates 12081..12497 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV41_RS26685 Protein ID WP_001261276.1
Coordinates 11854..12084 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV41_RS26650 (AI2765V1_5059) 6968..7237 + 270 WP_000339857.1 hypothetical protein -
LQV41_RS26655 (AI2765V1_5060) 7414..8280 - 867 WP_004118283.1 replication initiation protein -
LQV41_RS26660 8815..8919 + 105 WP_032409716.1 hypothetical protein -
LQV41_RS26665 (AI2765V1_5061) 9048..9305 + 258 WP_000764642.1 hypothetical protein -
LQV41_RS26670 (AI2765V1_5062) 9363..10139 - 777 WP_000015958.1 site-specific integrase -
LQV41_RS26675 (AI2765V1_5063) 10136..10879 - 744 WP_000129823.1 hypothetical protein -
LQV41_RS26680 (AI2765V1_5064) 10930..11280 - 351 WP_000493378.1 hypothetical protein -
LQV41_RS26685 (AI2765V1_5065) 11854..12084 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV41_RS26690 (AI2765V1_5066) 12081..12497 + 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV41_RS26695 (AI2765V1_REPA000000087) 12741..13597 + 857 Protein_15 IS3-like element ISEc15 family transposase -
LQV41_RS26700 (AI2765V1_5069) 13879..14955 + 1077 WP_000227969.1 IS110 family transposase -
LQV41_RS26705 (AI2765V1_REPA000000084) 14972..15250 + 279 Protein_17 IS3 family transposase -
LQV41_RS26710 (AI2765V1_5071) 15553..17109 - 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / sul1 / qacE / dfrA12 / aph(3')-Ia / qnrB1 / dfrA14 / blaCTX-M-15 - 1..64662 64662


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296336 WP_015063455.1 NZ_OW970438:12081-12497 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296336 WP_001261276.1 NZ_OW970438:11854-12084 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References