Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 116261..116784 Replicon plasmid P1
Accession NZ_OW970437
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LQV41_RS26590 Protein ID WP_015632464.1
Coordinates 116261..116566 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LQV41_RS26595 Protein ID WP_015632465.1
Coordinates 116566..116784 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV41_RS26545 (AI2765V1_5039) 111291..111719 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LQV41_RS26550 (AI2765V1_5040) 111712..112692 - 981 WP_015632457.1 plasmid segregation protein ParM -
LQV41_RS26555 (AI2765V1_5041) 113053..113235 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LQV41_RS26560 (AI2765V1_5042) 113261..113704 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LQV41_RS26565 113910..114032 - 123 Protein_120 transcriptional regulator -
LQV41_RS26570 (AI2765V1_5044) 114046..114273 - 228 WP_016162072.1 hypothetical protein -
LQV41_RS26575 114505..114960 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LQV41_RS26580 115212..115307 - 96 Protein_123 IS1 family transposase -
LQV41_RS26585 (AI2765V1_5047) 115772..116149 - 378 WP_016162069.1 hypothetical protein -
LQV41_RS26590 (AI2765V1_5048) 116261..116566 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV41_RS26595 (AI2765V1_5049) 116566..116784 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV41_RS26600 (AI2765V1_5050) 116970..117995 + 1026 WP_015632466.1 IS110 family transposase -
LQV41_RS26605 (AI2765V1_REPA000000035) 118290..118775 + 486 Protein_128 IS5 family transposase -
LQV41_RS26610 (AI2765V1_5051) 118939..119370 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LQV41_RS26615 (AI2765V1_5052) 119370..120641 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtF / ARR-3 - 1..121034 121034


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T296335 WP_015632464.1 NZ_OW970437:c116566-116261 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT296335 WP_015632465.1 NZ_OW970437:c116784-116566 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References