Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4751625..4752141 | Replicon | chromosome |
| Accession | NZ_OW970422 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | LQV34_RS23210 | Protein ID | WP_009486548.1 |
| Coordinates | 4751625..4751909 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | LQV34_RS23215 | Protein ID | WP_002886901.1 |
| Coordinates | 4751899..4752141 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV34_RS23185 (4747042) | 4747042..4747305 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| LQV34_RS23190 (4747435) | 4747435..4747608 | + | 174 | WP_032433782.1 | hypothetical protein | - |
| LQV34_RS23195 (4747611) | 4747611..4748354 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| LQV34_RS23200 (4748711) | 4748711..4750849 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQV34_RS23205 (4751157) | 4751157..4751621 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQV34_RS23210 (4751625) | 4751625..4751909 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQV34_RS23215 (4751899) | 4751899..4752141 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQV34_RS23220 (4752219) | 4752219..4754129 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| LQV34_RS23225 (4754152) | 4754152..4755306 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| LQV34_RS23230 (4755373) | 4755373..4756113 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T296316 WP_009486548.1 NZ_OW970422:c4751909-4751625 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |