Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4033117..4033736 Replicon chromosome
Accession NZ_OW970422
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV34_RS19735 Protein ID WP_002892050.1
Coordinates 4033518..4033736 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV34_RS19730 Protein ID WP_002892066.1
Coordinates 4033117..4033491 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV34_RS19720 (4028269) 4028269..4029462 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV34_RS19725 (4029485) 4029485..4032631 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV34_RS19730 (4033117) 4033117..4033491 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV34_RS19735 (4033518) 4033518..4033736 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV34_RS19740 (4033899) 4033899..4034465 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV34_RS19745 (4034437) 4034437..4034577 - 141 WP_004147370.1 hypothetical protein -
LQV34_RS19750 (4034598) 4034598..4035068 + 471 WP_020802585.1 YlaC family protein -
LQV34_RS19755 (4035043) 4035043..4036494 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV34_RS19760 (4036595) 4036595..4037293 + 699 WP_023287311.1 GNAT family protein -
LQV34_RS19765 (4037290) 4037290..4037430 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV34_RS19770 (4037430) 4037430..4037693 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296314 WP_002892050.1 NZ_OW970422:4033518-4033736 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296314 WP_002892066.1 NZ_OW970422:4033117-4033491 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References