Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1513979..1514715 | Replicon | chromosome |
Accession | NZ_OW970422 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | LQV34_RS07550 | Protein ID | WP_032433360.1 |
Coordinates | 1514233..1514715 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | LQV34_RS07545 | Protein ID | WP_003026799.1 |
Coordinates | 1513979..1514245 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV34_RS07520 (1509625) | 1509625..1510764 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
LQV34_RS07525 (1510793) | 1510793..1511455 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
LQV34_RS07530 (1511436) | 1511436..1512443 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
LQV34_RS07535 (1512461) | 1512461..1513093 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
LQV34_RS07540 (1513103) | 1513103..1513666 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
LQV34_RS07545 (1513979) | 1513979..1514245 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
LQV34_RS07550 (1514233) | 1514233..1514715 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
LQV34_RS07555 (1515076) | 1515076..1515675 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
LQV34_RS07560 (1515888) | 1515888..1516832 | - | 945 | WP_077254249.1 | fimbrial protein | - |
LQV34_RS07565 (1516844) | 1516844..1517104 | - | 261 | WP_035588053.1 | hypothetical protein | - |
LQV34_RS07570 (1517275) | 1517275..1518015 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1483425..1525507 | 42082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T296308 WP_032433360.1 NZ_OW970422:1514233-1514715 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |