Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 7248..7891 Replicon plasmid P2
Accession NZ_OW970415
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV26_RS26425 Protein ID WP_015063455.1
Coordinates 7248..7664 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV26_RS26430 Protein ID WP_001261276.1
Coordinates 7661..7891 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV26_RS26405 (AI2998V1_5017) 2636..4192 + 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -
LQV26_RS26410 (AI2998V1_REPA000000102) 4495..4773 - 279 Protein_4 IS3 family transposase -
LQV26_RS26415 (AI2998V1_5019) 4790..5866 - 1077 WP_000227969.1 IS110 family transposase -
LQV26_RS26420 (AI2998V1_REPA000000104) 6148..7004 - 857 Protein_6 IS3-like element ISEc15 family transposase -
LQV26_RS26425 (AI2998V1_5022) 7248..7664 - 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV26_RS26430 (AI2998V1_5023) 7661..7891 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV26_RS26435 (AI2998V1_5024) 8465..8815 + 351 WP_000493378.1 hypothetical protein -
LQV26_RS26440 (AI2998V1_5025) 8866..9609 + 744 WP_000129823.1 hypothetical protein -
LQV26_RS26445 (AI2998V1_5026) 9606..10382 + 777 WP_000015958.1 site-specific integrase -
LQV26_RS26450 (AI2998V1_5027) 10440..10697 - 258 WP_000764642.1 hypothetical protein -
LQV26_RS26455 10826..10930 - 105 WP_032409716.1 hypothetical protein -
LQV26_RS26460 (AI2998V1_5028) 11465..12331 + 867 WP_004118283.1 replication initiation protein -
LQV26_RS26465 (AI2998V1_5029) 12508..12777 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / blaCTX-M-15 / ARR-3 / rmtF / dfrA14 / qnrB1 / aph(3')-Ia / dfrA12 / qacE / sul1 - 1..83975 83975


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296303 WP_015063455.1 NZ_OW970415:c7664-7248 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296303 WP_001261276.1 NZ_OW970415:c7891-7661 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References