Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 98916..99439 Replicon plasmid P1
Accession NZ_OW970414
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LQV26_RS26360 Protein ID WP_015632464.1
Coordinates 98916..99221 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LQV26_RS26365 Protein ID WP_015632465.1
Coordinates 99221..99439 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV26_RS26315 (AI2998V1_5000) 93946..94374 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LQV26_RS26320 (AI2998V1_5001) 94367..95347 - 981 WP_015632457.1 plasmid segregation protein ParM -
LQV26_RS26325 (AI2998V1_5002) 95708..95890 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LQV26_RS26330 (AI2998V1_5003) 95916..96359 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LQV26_RS26335 96565..96687 - 123 Protein_103 transcriptional regulator -
LQV26_RS26340 (AI2998V1_5005) 96701..96928 - 228 WP_016162072.1 hypothetical protein -
LQV26_RS26345 97160..97615 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LQV26_RS26350 97867..97962 - 96 Protein_106 IS1 family transposase -
LQV26_RS26355 (AI2998V1_5008) 98427..98804 - 378 WP_016162069.1 hypothetical protein -
LQV26_RS26360 (AI2998V1_5009) 98916..99221 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV26_RS26365 (AI2998V1_5010) 99221..99439 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV26_RS26370 (AI2998V1_5011) 99625..100650 + 1026 WP_015632466.1 IS110 family transposase -
LQV26_RS26375 (AI2998V1_REPA000000048) 100945..101430 + 486 Protein_111 IS5 family transposase -
LQV26_RS26380 (AI2998V1_5012) 101594..102025 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LQV26_RS26385 (AI2998V1_5013) 102025..103296 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..103689 103689


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T296302 WP_015632464.1 NZ_OW970414:c99221-98916 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT296302 WP_015632465.1 NZ_OW970414:c99439-99221 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References