Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4655129..4655939 | Replicon | chromosome |
Accession | NZ_OW970413 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0H3GMP0 |
Locus tag | LQV26_RS22720 | Protein ID | WP_002887280.1 |
Coordinates | 4655129..4655662 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | LQV26_RS22725 | Protein ID | WP_002887278.1 |
Coordinates | 4655673..4655939 (-) | Length | 89 a.a. |
Genomic Context
Location: 4653961..4655082 (1122 bp)
Type: Others
Protein ID: WP_009309849.1
Type: Others
Protein ID: WP_009309849.1
Location: 4658321..4659706 (1386 bp)
Type: Others
Protein ID: WP_032431458.1
Type: Others
Protein ID: WP_032431458.1
Location: 4659724..4660029 (306 bp)
Type: Others
Protein ID: WP_032432083.1
Type: Others
Protein ID: WP_032432083.1
Location: 4655129..4655662 (534 bp)
Type: Toxin
Protein ID: WP_002887280.1
Type: Toxin
Protein ID: WP_002887280.1
Location: 4655673..4655939 (267 bp)
Type: Antitoxin
Protein ID: WP_002887278.1
Type: Antitoxin
Protein ID: WP_002887278.1
Location: 4656042..4657475 (1434 bp)
Type: Others
Protein ID: WP_023288193.1
Type: Others
Protein ID: WP_023288193.1
Location: 4657465..4658148 (684 bp)
Type: Others
Protein ID: WP_032105399.1
Type: Others
Protein ID: WP_032105399.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV26_RS22715 (4653961) | 4653961..4655082 | + | 1122 | WP_009309849.1 | cupin domain-containing protein | - |
LQV26_RS22720 (4655129) | 4655129..4655662 | - | 534 | WP_002887280.1 | type II toxin-antitoxin system toxin KacT | Toxin |
LQV26_RS22725 (4655673) | 4655673..4655939 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
LQV26_RS22730 (4656042) | 4656042..4657475 | - | 1434 | WP_023288193.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
LQV26_RS22735 (4657465) | 4657465..4658148 | - | 684 | WP_032105399.1 | copper response regulator transcription factor CusR | - |
LQV26_RS22740 (4658321) | 4658321..4659706 | + | 1386 | WP_032431458.1 | efflux transporter outer membrane subunit | - |
LQV26_RS22745 (4659724) | 4659724..4660029 | + | 306 | WP_032432083.1 | cation efflux system protein CusF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19838.70 Da Isoelectric Point: 5.2614
>T296299 WP_002887280.1 NZ_OW970413:c4655662-4655129 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp