Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4040422..4041041 Replicon chromosome
Accession NZ_OW970413
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV26_RS19775 Protein ID WP_002892050.1
Coordinates 4040823..4041041 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV26_RS19770 Protein ID WP_002892066.1
Coordinates 4040422..4040796 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV26_RS19760 (4035574) 4035574..4036767 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV26_RS19765 (4036790) 4036790..4039936 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV26_RS19770 (4040422) 4040422..4040796 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV26_RS19775 (4040823) 4040823..4041041 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV26_RS19780 (4041204) 4041204..4041770 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV26_RS19785 (4041742) 4041742..4041882 - 141 WP_004147370.1 hypothetical protein -
LQV26_RS19790 (4041903) 4041903..4042373 + 471 WP_020802585.1 YlaC family protein -
LQV26_RS19795 (4042348) 4042348..4043799 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV26_RS19800 (4043900) 4043900..4044598 + 699 WP_023287311.1 GNAT family protein -
LQV26_RS19805 (4044595) 4044595..4044735 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV26_RS19810 (4044735) 4044735..4044998 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296298 WP_002892050.1 NZ_OW970413:4040823-4041041 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296298 WP_002892066.1 NZ_OW970413:4040422-4040796 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References