Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1496524..1497167 | Replicon | chromosome |
| Accession | NZ_OW970413 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | LQV26_RS07445 | Protein ID | WP_032433387.1 |
| Coordinates | 1496751..1497167 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV26_RS07440 | Protein ID | WP_001261276.1 |
| Coordinates | 1496524..1496754 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV26_RS07425 (1491546) | 1491546..1492633 | + | 1088 | Protein_1453 | transcriptional repressor PifC | - |
| LQV26_RS07430 (1492636) | 1492636..1494876 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| LQV26_RS07435 (1495404) | 1495404..1496219 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| LQV26_RS07440 (1496524) | 1496524..1496754 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV26_RS07445 (1496751) | 1496751..1497167 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV26_RS07450 (1497323) | 1497323..1498303 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| LQV26_RS07455 (1498498) | 1498498..1500069 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| LQV26_RS07460 (1500388) | 1500388..1500636 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| LQV26_RS07465 (1500695) | 1500695..1501213 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| LQV26_RS07470 (1501244) | 1501244..1501735 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| LQV26_RS07475 (1501795) | 1501795..1501998 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1483438..1528580 | 45142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296291 WP_032433387.1 NZ_OW970413:1496751-1497167 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |