Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 19884..20527 Replicon plasmid P2
Accession NZ_OW970367
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV23_RS26745 Protein ID WP_015063455.1
Coordinates 20111..20527 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV23_RS26740 Protein ID WP_001261276.1
Coordinates 19884..20114 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV23_RS26705 (AI3000V1_5068) 14998..15267 + 270 WP_000339857.1 hypothetical protein -
LQV23_RS26710 (AI3000V1_5069) 15444..16310 - 867 WP_004118283.1 replication initiation protein -
LQV23_RS26715 16845..16949 + 105 WP_032409716.1 hypothetical protein -
LQV23_RS26720 (AI3000V1_5070) 17078..17335 + 258 WP_000764642.1 hypothetical protein -
LQV23_RS26725 (AI3000V1_5071) 17393..18169 - 777 WP_000015958.1 site-specific integrase -
LQV23_RS26730 (AI3000V1_5072) 18166..18909 - 744 WP_000129823.1 hypothetical protein -
LQV23_RS26735 (AI3000V1_5073) 18960..19310 - 351 WP_000493378.1 hypothetical protein -
LQV23_RS26740 (AI3000V1_5074) 19884..20114 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV23_RS26745 (AI3000V1_5075) 20111..20527 + 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV23_RS26750 (AI3000V1_REPA000000092) 20771..21627 + 857 Protein_23 IS3-like element ISEc15 family transposase -
LQV23_RS26755 (AI3000V1_5078) 21909..22985 + 1077 WP_000227969.1 IS110 family transposase -
LQV23_RS26760 (AI3000V1_REPA000000089) 23002..23280 + 279 Protein_25 IS3 family transposase -
LQV23_RS26765 (AI3000V1_5080) 23583..25139 - 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-15 / mph(A) / sul1 / qacE / dfrA14 / qnrB1 / aph(3')-Ia / dfrA12 - 1..65762 65762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296272 WP_015063455.1 NZ_OW970367:20111-20527 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296272 WP_001261276.1 NZ_OW970367:19884-20114 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References