Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4039973..4040592 Replicon chromosome
Accession NZ_OW970365
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQV23_RS19750 Protein ID WP_002892050.1
Coordinates 4040374..4040592 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQV23_RS19745 Protein ID WP_002892066.1
Coordinates 4039973..4040347 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV23_RS19735 (4035125) 4035125..4036318 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQV23_RS19740 (4036341) 4036341..4039487 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LQV23_RS19745 (4039973) 4039973..4040347 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQV23_RS19750 (4040374) 4040374..4040592 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQV23_RS19755 (4040755) 4040755..4041321 + 567 WP_002892030.1 maltose O-acetyltransferase -
LQV23_RS19760 (4041293) 4041293..4041433 - 141 WP_004147370.1 hypothetical protein -
LQV23_RS19765 (4041454) 4041454..4041924 + 471 WP_020802585.1 YlaC family protein -
LQV23_RS19770 (4041899) 4041899..4043350 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LQV23_RS19775 (4043451) 4043451..4044149 + 699 WP_023287311.1 GNAT family protein -
LQV23_RS19780 (4044146) 4044146..4044286 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LQV23_RS19785 (4044286) 4044286..4044549 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296266 WP_002892050.1 NZ_OW970365:4040374-4040592 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296266 WP_002892066.1 NZ_OW970365:4039973-4040347 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References