Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 30575..31218 Replicon plasmid P2
Accession NZ_OW970359
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name vagD Uniprot ID R9WRW3
Locus tag LQV29_RS26755 Protein ID WP_015063455.1
Coordinates 30575..30991 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQV29_RS26760 Protein ID WP_001261276.1
Coordinates 30988..31218 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV29_RS26735 (AI2775V1_5070) 25963..27519 + 1557 WP_053897648.1 PAS domain-containing methyl-accepting chemotaxis protein -
LQV29_RS26740 (AI2775V1_REPA000000084) 27822..28100 - 279 Protein_30 IS3 family transposase -
LQV29_RS26745 (AI2775V1_5072) 28117..29193 - 1077 WP_000227969.1 IS110 family transposase -
LQV29_RS26750 (AI2775V1_REPA000000086) 29475..30331 - 857 Protein_32 IS3-like element ISEc15 family transposase -
LQV29_RS26755 (AI2775V1_5075) 30575..30991 - 417 WP_015063455.1 type II toxin-antitoxin system VapC family toxin Toxin
LQV29_RS26760 (AI2775V1_5076) 30988..31218 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQV29_RS26765 (AI2775V1_5077) 31792..32142 + 351 WP_000493378.1 hypothetical protein -
LQV29_RS26770 (AI2775V1_5078) 32193..32936 + 744 WP_000129823.1 hypothetical protein -
LQV29_RS26775 (AI2775V1_5079) 32933..33709 + 777 WP_000015958.1 site-specific integrase -
LQV29_RS26780 (AI2775V1_5080) 33767..34024 - 258 WP_000764642.1 hypothetical protein -
LQV29_RS26785 34153..34257 - 105 WP_032409716.1 hypothetical protein -
LQV29_RS26790 (AI2775V1_5081) 34792..35658 + 867 WP_004118283.1 replication initiation protein -
LQV29_RS26795 (AI2775V1_5082) 35835..36104 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / aph(3')-Ia / dfrA12 / qacE / sul1 / mph(A) / blaCTX-M-15 / dfrA14 - 1..67089 67089


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15036.50 Da        Isoelectric Point: 8.5440

>T296255 WP_015063455.1 NZ_OW970359:c30991-30575 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296255 WP_001261276.1 NZ_OW970359:c31218-30988 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R9WRW3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References