Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 30575..31218 | Replicon | plasmid P2 |
| Accession | NZ_OW970359 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | R9WRW3 |
| Locus tag | LQV29_RS26755 | Protein ID | WP_015063455.1 |
| Coordinates | 30575..30991 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQV29_RS26760 | Protein ID | WP_001261276.1 |
| Coordinates | 30988..31218 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV29_RS26735 (AI2775V1_5070) | 25963..27519 | + | 1557 | WP_053897648.1 | PAS domain-containing methyl-accepting chemotaxis protein | - |
| LQV29_RS26740 (AI2775V1_REPA000000084) | 27822..28100 | - | 279 | Protein_30 | IS3 family transposase | - |
| LQV29_RS26745 (AI2775V1_5072) | 28117..29193 | - | 1077 | WP_000227969.1 | IS110 family transposase | - |
| LQV29_RS26750 (AI2775V1_REPA000000086) | 29475..30331 | - | 857 | Protein_32 | IS3-like element ISEc15 family transposase | - |
| LQV29_RS26755 (AI2775V1_5075) | 30575..30991 | - | 417 | WP_015063455.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQV29_RS26760 (AI2775V1_5076) | 30988..31218 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQV29_RS26765 (AI2775V1_5077) | 31792..32142 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| LQV29_RS26770 (AI2775V1_5078) | 32193..32936 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| LQV29_RS26775 (AI2775V1_5079) | 32933..33709 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| LQV29_RS26780 (AI2775V1_5080) | 33767..34024 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| LQV29_RS26785 | 34153..34257 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| LQV29_RS26790 (AI2775V1_5081) | 34792..35658 | + | 867 | WP_004118283.1 | replication initiation protein | - |
| LQV29_RS26795 (AI2775V1_5082) | 35835..36104 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | qnrB1 / aph(3')-Ia / dfrA12 / qacE / sul1 / mph(A) / blaCTX-M-15 / dfrA14 | - | 1..67089 | 67089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15036.50 Da Isoelectric Point: 8.5440
>T296255 WP_015063455.1 NZ_OW970359:c30991-30575 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R9WRW3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |