Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 111500..112023 Replicon plasmid P1
Accession NZ_OW970358
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LQV29_RS26560 Protein ID WP_015632464.1
Coordinates 111500..111805 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LQV29_RS26565 Protein ID WP_015632465.1
Coordinates 111805..112023 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV29_RS26515 (AI2775V1_5030) 106530..106958 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LQV29_RS26520 (AI2775V1_5031) 106951..107931 - 981 WP_015632457.1 plasmid segregation protein ParM -
LQV29_RS26525 (AI2775V1_5032) 108292..108474 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LQV29_RS26530 (AI2775V1_5033) 108500..108943 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LQV29_RS26535 109149..109271 - 123 Protein_115 transcriptional regulator -
LQV29_RS26540 (AI2775V1_5035) 109285..109512 - 228 WP_016162072.1 hypothetical protein -
LQV29_RS26545 109744..110199 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LQV29_RS26550 110451..110546 - 96 Protein_118 IS1 family transposase -
LQV29_RS26555 (AI2775V1_5038) 111011..111388 - 378 WP_016162069.1 hypothetical protein -
LQV29_RS26560 (AI2775V1_5039) 111500..111805 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LQV29_RS26565 (AI2775V1_5040) 111805..112023 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LQV29_RS26570 (AI2775V1_5041) 112209..113234 + 1026 WP_015632466.1 IS110 family transposase -
LQV29_RS26575 (AI2775V1_REPA000000033) 113529..114014 + 486 Protein_123 IS5 family transposase -
LQV29_RS26580 (AI2775V1_5042) 114178..114609 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LQV29_RS26585 (AI2775V1_5043) 114609..115880 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtF / ARR-3 - 1..116273 116273


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T296254 WP_015632464.1 NZ_OW970358:c111805-111500 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT296254 WP_015632465.1 NZ_OW970358:c112023-111805 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References