Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1497121..1497764 | Replicon | chromosome |
Accession | NZ_OW970357 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | LQV29_RS07445 | Protein ID | WP_032433387.1 |
Coordinates | 1497348..1497764 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | LQV29_RS07440 | Protein ID | WP_001261276.1 |
Coordinates | 1497121..1497351 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV29_RS07425 (1492143) | 1492143..1493230 | + | 1088 | Protein_1453 | transcriptional repressor PifC | - |
LQV29_RS07430 (1493233) | 1493233..1495473 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
LQV29_RS07435 (1496001) | 1496001..1496816 | - | 816 | WP_032433388.1 | hypothetical protein | - |
LQV29_RS07440 (1497121) | 1497121..1497351 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQV29_RS07445 (1497348) | 1497348..1497764 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQV29_RS07450 (1497920) | 1497920..1498900 | + | 981 | WP_032433385.1 | hypothetical protein | - |
LQV29_RS07455 (1499095) | 1499095..1500666 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
LQV29_RS07460 (1500985) | 1500985..1501233 | + | 249 | WP_032433382.1 | hypothetical protein | - |
LQV29_RS07465 (1501292) | 1501292..1501810 | + | 519 | WP_045326794.1 | hypothetical protein | - |
LQV29_RS07470 (1501841) | 1501841..1502332 | + | 492 | WP_032433378.1 | hypothetical protein | - |
LQV29_RS07475 (1502392) | 1502392..1502595 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1484035..1525340 | 41305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T296242 WP_032433387.1 NZ_OW970357:1497348-1497764 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |