Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 161666..162219 | Replicon | plasmid P2 |
| Accession | NZ_OW970317 | ||
| Organism | Pantoea agglomerans strain DAPP-PG734 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | OOS96_RS24000 | Protein ID | WP_031594618.1 |
| Coordinates | 161905..162219 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | OOS96_RS23995 | Protein ID | WP_031594617.1 |
| Coordinates | 161666..161902 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOS96_RS23965 (DAPPPG734_24295) | 157118..157369 | + | 252 | WP_152551423.1 | hypothetical protein | - |
| OOS96_RS23970 (DAPPPG734_24300) | 157422..157622 | - | 201 | WP_235188787.1 | hypothetical protein | - |
| OOS96_RS23975 (DAPPPG734_24305) | 157802..158029 | - | 228 | WP_235188788.1 | hypothetical protein | - |
| OOS96_RS23980 (DAPPPG734_24310) | 158184..158483 | - | 300 | WP_031594614.1 | hypothetical protein | - |
| OOS96_RS23985 (DAPPPG734_24315) | 158480..160024 | - | 1545 | WP_031594615.1 | methyl-accepting chemotaxis protein | - |
| OOS96_RS23990 (DAPPPG734_24320) | 160203..161246 | + | 1044 | Protein_164 | translesion error-prone DNA polymerase V subunit UmuC | - |
| OOS96_RS23995 (DAPPPG734_24325) | 161666..161902 | + | 237 | WP_031594617.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| OOS96_RS24000 (DAPPPG734_24330) | 161905..162219 | + | 315 | WP_031594618.1 | CcdB family protein | Toxin |
| OOS96_RS24005 (DAPPPG734_24335) | 162361..162609 | - | 249 | WP_031594619.1 | hypothetical protein | - |
| OOS96_RS24010 (DAPPPG734_24340) | 162711..162914 | - | 204 | WP_031594620.1 | plasmid partition protein ParG | - |
| OOS96_RS24015 (DAPPPG734_24345) | 162911..163534 | - | 624 | WP_031594621.1 | ParA family partition ATPase | - |
| OOS96_RS24020 (DAPPPG734_24350) | 163813..164607 | - | 795 | WP_052272223.1 | site-specific integrase | - |
| OOS96_RS24025 (DAPPPG734_24355) | 164600..165148 | - | 549 | WP_031594495.1 | hypothetical protein | - |
| OOS96_RS24030 (DAPPPG734_24360) | 165245..165694 | - | 450 | WP_031594496.1 | hypothetical protein | - |
| OOS96_RS24035 (DAPPPG734_24365) | 165778..166713 | - | 936 | WP_031594497.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..174327 | 174327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11658.60 Da Isoelectric Point: 5.8036
>T296236 WP_031594618.1 NZ_OW970317:161905-162219 [Pantoea agglomerans]
MQFTVYSNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPLEKYPSSTRPERLVPLIRLTDDKEYAVMTHEMASIPTRALG
AVFCDSSLYRTEIKAAIDFLLDGI
MQFTVYSNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPLEKYPSSTRPERLVPLIRLTDDKEYAVMTHEMASIPTRALG
AVFCDSSLYRTEIKAAIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|