Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 161666..162219 Replicon plasmid P2
Accession NZ_OW970317
Organism Pantoea agglomerans strain DAPP-PG734

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag OOS96_RS24000 Protein ID WP_031594618.1
Coordinates 161905..162219 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID -
Locus tag OOS96_RS23995 Protein ID WP_031594617.1
Coordinates 161666..161902 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOS96_RS23965 (DAPPPG734_24295) 157118..157369 + 252 WP_152551423.1 hypothetical protein -
OOS96_RS23970 (DAPPPG734_24300) 157422..157622 - 201 WP_235188787.1 hypothetical protein -
OOS96_RS23975 (DAPPPG734_24305) 157802..158029 - 228 WP_235188788.1 hypothetical protein -
OOS96_RS23980 (DAPPPG734_24310) 158184..158483 - 300 WP_031594614.1 hypothetical protein -
OOS96_RS23985 (DAPPPG734_24315) 158480..160024 - 1545 WP_031594615.1 methyl-accepting chemotaxis protein -
OOS96_RS23990 (DAPPPG734_24320) 160203..161246 + 1044 Protein_164 translesion error-prone DNA polymerase V subunit UmuC -
OOS96_RS23995 (DAPPPG734_24325) 161666..161902 + 237 WP_031594617.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OOS96_RS24000 (DAPPPG734_24330) 161905..162219 + 315 WP_031594618.1 CcdB family protein Toxin
OOS96_RS24005 (DAPPPG734_24335) 162361..162609 - 249 WP_031594619.1 hypothetical protein -
OOS96_RS24010 (DAPPPG734_24340) 162711..162914 - 204 WP_031594620.1 plasmid partition protein ParG -
OOS96_RS24015 (DAPPPG734_24345) 162911..163534 - 624 WP_031594621.1 ParA family partition ATPase -
OOS96_RS24020 (DAPPPG734_24350) 163813..164607 - 795 WP_052272223.1 site-specific integrase -
OOS96_RS24025 (DAPPPG734_24355) 164600..165148 - 549 WP_031594495.1 hypothetical protein -
OOS96_RS24030 (DAPPPG734_24360) 165245..165694 - 450 WP_031594496.1 hypothetical protein -
OOS96_RS24035 (DAPPPG734_24365) 165778..166713 - 936 WP_031594497.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..174327 174327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(9-78)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11658.60 Da        Isoelectric Point: 5.8036

>T296236 WP_031594618.1 NZ_OW970317:161905-162219 [Pantoea agglomerans]
MQFTVYSNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPLEKYPSSTRPERLVPLIRLTDDKEYAVMTHEMASIPTRALG
AVFCDSSLYRTEIKAAIDFLLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8982.90 Da        Isoelectric Point: 4.6234

>AT296236 WP_031594617.1 NZ_OW970317:161666-161902 [Pantoea agglomerans]
MAITQRATQSVTMTVERDLLSRAREAGINLSATLTTALDAELRQYESKKWQEENSEALEALNRFHDEHGCFSDEYRTF

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References