Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3148708..3149325 Replicon chromosome
Accession NZ_OW970315
Organism Pantoea agglomerans strain DAPP-PG734

Toxin (Protein)


Gene name Hha Uniprot ID E0LTU7
Locus tag OOS96_RS14870 Protein ID WP_003850458.1
Coordinates 3149110..3149325 (+) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID E0LTU8
Locus tag OOS96_RS14865 Protein ID WP_003850455.1
Coordinates 3148708..3149085 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOS96_RS14835 (DAPPPG734_15025) 3145015..3145269 + 255 WP_010671219.1 type B 50S ribosomal protein L31 -
OOS96_RS14840 (DAPPPG734_15030) 3145281..3145421 + 141 WP_010255896.1 type B 50S ribosomal protein L36 -
OOS96_RS14845 (DAPPPG734_15035) 3145467..3146345 - 879 WP_031592168.1 metal ABC transporter substrate-binding protein -
OOS96_RS14850 (DAPPPG734_15040) 3146361..3147200 - 840 WP_031592170.1 metal ABC transporter permease -
OOS96_RS14855 (DAPPPG734_15045) 3147197..3147865 - 669 WP_031592171.1 ABC transporter ATP-binding protein -
OOS96_RS14860 (DAPPPG734_15055) 3148207..3148560 + 354 WP_031592173.1 hypothetical protein -
OOS96_RS14865 (DAPPPG734_15060) 3148708..3149085 + 378 WP_003850455.1 Hha toxicity modulator TomB Antitoxin
OOS96_RS14870 (DAPPPG734_15065) 3149110..3149325 + 216 WP_003850458.1 HHA domain-containing protein Toxin
OOS96_RS14880 (DAPPPG734_15075) 3149733..3150044 + 312 WP_031592174.1 MGMT family protein -
OOS96_RS14885 (DAPPPG734_15080) 3150084..3150641 - 558 WP_010255881.1 YbaY family lipoprotein -
OOS96_RS14890 (DAPPPG734_15085) 3150832..3151695 + 864 WP_010255880.1 acyl-CoA thioesterase II -
OOS96_RS14895 (DAPPPG734_15090) 3151746..3153032 - 1287 WP_010255877.1 ammonium transporter AmtB -
OOS96_RS14900 (DAPPPG734_15095) 3153067..3153405 - 339 WP_003850469.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8510.90 Da        Isoelectric Point: 9.4825

>T296233 WP_003850458.1 NZ_OW970315:3149110-3149325 [Pantoea agglomerans]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14636.25 Da        Isoelectric Point: 4.3976

>AT296233 WP_003850455.1 NZ_OW970315:3148708-3149085 [Pantoea agglomerans]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I5AGC3

Antitoxin

Source ID Structure
AlphaFold DB A0A1I5AG55

References